PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.9KG081500.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NAC
Protein Properties Length: 340aa    MW: 37098 Da    PI: 7.3411
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.9KG081500.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1806.3e-5661311128
                  NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                          lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePwdLp k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgkdk
  Pavir.9KG081500.1.p   6 LPPGFRFHPTDEELVTYYLTRKVSDFAFAT-RAIADVDLNKCEPWDLPGKASMGEKEWYFFSMRDRKYPTGIRTNRATDSGYWKTTGKDK 94 
                          79*************************999.89***************988999************************************ PP

                  NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                          e+++  g lvg+kktLvfy+grapkgekt+Wvmheyrl
  Pavir.9KG081500.1.p  95 EIFH-CGMLVGMKKTLVFYRGRAPKGEKTSWVMHEYRL 131
                          ****.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.44E-642152IPR003441NAC domain
PROSITE profilePS5100560.3776152IPR003441NAC domain
PfamPF023652.9E-297131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MDQEGLPPGF RFHPTDEELV TYYLTRKVSD FAFATRAIAD VDLNKCEPWD LPGKASMGEK  60
EWYFFSMRDR KYPTGIRTNR ATDSGYWKTT GKDKEIFHCG MLVGMKKTLV FYRGRAPKGE  120
KTSWVMHEYR LQNKFPYKPN KEEWVVCRVF KKCQIIKMRP PHGSPTMDDS PCHDGNASLG  180
ELGELDVSSI LGGFAPAAAH TSSTSSPGAL HHQGAGGESF GHRVGVDMNA YMSWMAAANQ  240
GAAAAAAAAA MLPWATTAPG LFGNVFASPN HQLVQKPLPF AGCSQPRDLG GGVAANVGSE  300
HHAMFASTLA KLEMECDQQP AAPAPEQQLG MDESTWRAF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B3e-57115212165NAC domain-containing protein 19
4dul_A3e-57115212165NAC domain-containing protein 19
1ut7_B3e-57115212165NO APICAL MERISTEM PROTEIN
1ut7_A3e-57115212165NO APICAL MERISTEM PROTEIN
1ut4_B3e-57115212165NO APICAL MERISTEM PROTEIN
1ut4_A3e-57115212165NO APICAL MERISTEM PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pvr.323230.0root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982400.10.0PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
TrEMBLK4ACC80.0K4ACC8_SETIT; Uncharacterized protein
STRINGSi036535m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-91NAC domain containing protein 58